- GRAP Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91969
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- GRAP
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: ELVDFYRTTT IAKKRQIFLR DEEPLLKSPG ACFAQAQFDF SAQDPSQLSF RRGDIIEVLE RPDPHWWRGR SCGRVGFFPR SYVQPVHL
- GRB2 related adaptor protein
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- DFNB114
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
Specifications/Features
Available conjugates: Unconjugated